SCOP 1.57: Domain d1gtb_1: 1gtb 81-218

Lineage for d1gtb_1 (1gtb 81-218)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (5 PDB entries)

8. Domain d1gtb_1: 1gtb 81-218 [17722]
   Other proteins in same PDB: d1gtb_2

Details for d1gtb_1

PDB Entry: 1gtb, 2.6 Å

PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel

SCOP Domain Sequences for d1gtb_1:

Sequence; same for both SEQRES and ATOM records:

>d1gtb_1 a.45.1.1 (81-218) Glutathione S-transferase {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppk

Timeline for d1gtb_1:

• d1gtb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1gtb_1 appears in SCOP 1.59
  
• d1gtb_1 appears in the current release, SCOPe 2.08, called d1gtba1