SCOP 1.65: Domain d1gne_1: 1gne 80-232

Lineage for d1gne_1 (1gne 80-232)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (8 PDB entries)

8. Domain d1gne_1: 1gne 80-232 [17721]
   Other proteins in same PDB: d1gne_2
   fused with a gp41 epitope of HIV-1
   complexed with gsh

Details for d1gne_1

PDB Entry: 1gne, 2.5 Å

PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1

SCOP Domain Sequences for d1gne_1:

Sequence; same for both SEQRES and ATOM records:

>d1gne_1 a.45.1.1 (80-232) Class alpha GST {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppksdlvprgsmeldkwa

Timeline for d1gne_1:

• d1gne_1 first appeared (with stable ids) in SCOP 1.55
  
• d1gne_1 appears in SCOP 1.63
  
• d1gne_1 appears in SCOP 1.67
  
• d1gne_1 appears in the current release, SCOPe 2.08, called d1gnea1