Lineage for d1gne_1 (1gne 80-232)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3939Species Schistosoma japonicum [TaxId:6182] [47633] (5 PDB entries)
  8. 3943Domain d1gne_1: 1gne 80-232 [17721]
    Other proteins in same PDB: d1gne_2

Details for d1gne_1

PDB Entry: 1gne (more details), 2.5 Å

PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1

SCOP Domain Sequences for d1gne_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gne_1 a.45.1.1 (80-232) Glutathione S-transferase {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppksdlvprgsmeldkwa

SCOP Domain Coordinates for d1gne_1:

Click to download the PDB-style file with coordinates for d1gne_1.
(The format of our PDB-style files is described here.)

Timeline for d1gne_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gne_2