Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries) |
Domain d3h5kb_: 3h5k B: [177200] automated match to d1gika_ complexed with edo, nag |
PDB Entry: 3h5k (more details), 1.45 Å
SCOPe Domain Sequences for d3h5kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5kb_ d.165.1.1 (B:) automated matches {Phytolacca dioica [TaxId: 29725]} intitydagnttinkyatfmeslrneakdpslqcygipmlpnnsstikyllvklqgasqk titlmlrrnnlyvmgysdpfngncryhifnditgtertnventlcsssssrdakpinyns lystlekkaevnsrsqvqlgiqilssdigkisgqssftdkteakfllvaiqmvseaarfk yienqvktnfnrdfspndkildleenwgkistaihdatngalpkplelknadgtkwivlr vdeikpdmgllnyvngtcqtt
Timeline for d3h5kb_: