Lineage for d1gta_1 (1gta 81-218)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily) Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) 
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins) 
Protein Glutathione S-transferase [47618] (27 species) 
Species Schistosoma japonicum [TaxId:6182] [47633] (5 PDB entries) 
Domain d1gta_1: 1gta 81-218 [17720]
Other proteins in same PDB: d1gta_2
Details for d1gta_1
PDB Entry: 1gta (more details), 2.4 Å
PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
SCOP Domain Sequences for d1gta_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gta_1 a.45.1.1 (81-218) Glutathione S-transferase {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppk
SCOP Domain Coordinates for d1gta_1:
Click to download the PDB-style file with coordinates for d1gta_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gta_1:
- d1gta_1 first appeared (with stable ids) in SCOP 1.55
- d1gta_1 appears in SCOP 1.59
- d1gta_1 appears in SCOP 1.63
- d1gta_1 appears in the current release, SCOPe 2.08, called d1gtaa1
View in 3D
