Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries) Uniprot P08515 |
Domain d1dugb1: 1dug B:81-220 [17719] Other proteins in same PDB: d1duga2, d1dugb2 fused with synthetic linker-c-terminal fibrinogen gamma chain fragment |
PDB Entry: 1dug (more details), 1.8 Å
SCOP Domain Sequences for d1dugb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dugb1 a.45.1.1 (B:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw plqgwqatfgggdhppksdp
Timeline for d1dugb1: