SCOP 1.65: Domain d1dugb1: 1dug B:81-220

Lineage for d1dugb1 (1dug B:81-220)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (8 PDB entries)

8. Domain d1dugb1: 1dug B:81-220 [17719]
   Other proteins in same PDB: d1duga2, d1dugb2
   fused with synthetic linker-c-terminal fibrinogen gamma chain fragment

Details for d1dugb1

PDB Entry: 1dug, 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization

SCOP Domain Sequences for d1dugb1:

Sequence; same for both SEQRES and ATOM records:

>d1dugb1 a.45.1.1 (B:81-220) Class alpha GST {Schistosoma japonicum}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdp

Timeline for d1dugb1:

• d1dugb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dugb1 appears in SCOP 1.63
  
• d1dugb1 appears in SCOP 1.67
  
• d1dugb1 appears in the current release, SCOPe 2.08