Lineage for d1duga1 (1dug A:81-220)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 213865Protein Class alpha GST [81349] (6 species)
  7. 213920Species Schistosoma japonicum [TaxId:6182] [47633] (5 PDB entries)
  8. 213921Domain d1duga1: 1dug A:81-220 [17718]
    Other proteins in same PDB: d1duga2, d1dugb2

Details for d1duga1

PDB Entry: 1dug (more details), 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization

SCOP Domain Sequences for d1duga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdp

SCOP Domain Coordinates for d1duga1:

Click to download the PDB-style file with coordinates for d1duga1.
(The format of our PDB-style files is described here.)

Timeline for d1duga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1duga2