Lineage for d1duga1 (1dug A:81-220)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153342Species Schistosoma japonicum [TaxId:6182] [47633] (5 PDB entries)
  8. 153343Domain d1duga1: 1dug A:81-220 [17718]
    Other proteins in same PDB: d1duga2, d1dugb2

Details for d1duga1

PDB Entry: 1dug (more details), 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization

SCOP Domain Sequences for d1duga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duga1 a.45.1.1 (A:81-220) Glutathione S-transferase {Schistosoma japonicum}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdp

SCOP Domain Coordinates for d1duga1:

Click to download the PDB-style file with coordinates for d1duga1.
(The format of our PDB-style files is described here.)

Timeline for d1duga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1duga2