Lineage for d1eema1 (1eem A:103-241)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443600Protein Class omega GST [81352] (1 species)
  7. 443601Species Human (Homo sapiens) [TaxId:9606] [47632] (1 PDB entry)
  8. 443602Domain d1eema1: 1eem A:103-241 [17717]
    Other proteins in same PDB: d1eema2

Details for d1eema1

PDB Entry: 1eem (more details), 2 Å

PDB Description: glutathione transferase from homo sapiens

SCOP Domain Sequences for d1eema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens)}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

SCOP Domain Coordinates for d1eema1:

Click to download the PDB-style file with coordinates for d1eema1.
(The format of our PDB-style files is described here.)

Timeline for d1eema1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eema2