Class a: All alpha proteins [46456] (226 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class sigma GST [81351] (5 species) |
Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries) |
Domain d1gsq_1: 1gsq 76-202 [17716] Other proteins in same PDB: d1gsq_2 complexed with gdb |
PDB Entry: 1gsq (more details), 2.4 Å
SCOP Domain Sequences for d1gsq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsq_1 a.45.1.1 (76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus)} ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk krpvrdf
Timeline for d1gsq_1: