Lineage for d2gsq_1 (2gsq 76-202)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443722Protein Class sigma GST [81351] (5 species)
  7. 443747Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries)
  8. 443748Domain d2gsq_1: 2gsq 76-202 [17715]
    Other proteins in same PDB: d2gsq_2

Details for d2gsq_1

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione
PDB Compounds: ( :)

SCOP Domain Sequences for d2gsq_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsq_1 a.45.1.1 (76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

SCOP Domain Coordinates for d2gsq_1:

Click to download the PDB-style file with coordinates for d2gsq_1.
(The format of our PDB-style files is described here.)

Timeline for d2gsq_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsq_2