SCOP 1.67: Domain d2gsq_1: 2gsq 76-202

Lineage for d2gsq_1 (2gsq 76-202)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class sigma GST [81351] (4 species)

7. Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries)

8. Domain d2gsq_1: 2gsq 76-202 [17715]
   Other proteins in same PDB: d2gsq_2
   complexed with gbi, so4

Details for d2gsq_1

PDB Entry: 2gsq, 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

SCOP Domain Sequences for d2gsq_1:

Sequence; same for both SEQRES and ATOM records:

>d2gsq_1 a.45.1.1 (76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

Timeline for d2gsq_1:

• d2gsq_1 first appeared (with stable ids) in SCOP 1.55
  
• d2gsq_1 appears in SCOP 1.65
  
• d2gsq_1 appears in SCOP 1.69
  
• d2gsq_1 appears in the current release, SCOPe 2.08, called d2gsqa1