Lineage for d2gsq_1 (2gsq 76-202)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 214137Protein Class sigma GST [81351] (3 species)
  7. 214144Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries)
  8. 214145Domain d2gsq_1: 2gsq 76-202 [17715]
    Other proteins in same PDB: d2gsq_2
    complexed with gbi, so4

Details for d2gsq_1

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

SCOP Domain Sequences for d2gsq_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsq_1 a.45.1.1 (76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

SCOP Domain Coordinates for d2gsq_1:

Click to download the PDB-style file with coordinates for d2gsq_1.
(The format of our PDB-style files is described here.)

Timeline for d2gsq_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsq_2