Lineage for d2gsq_1 (2gsq 76-202)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153354Species Squid (Ommastrephes sloani pacificus), class sigma [47631] (2 PDB entries)
  8. 153355Domain d2gsq_1: 2gsq 76-202 [17715]
    Other proteins in same PDB: d2gsq_2

Details for d2gsq_1

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

SCOP Domain Sequences for d2gsq_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsq_1 a.45.1.1 (76-202) Glutathione S-transferase {Squid (Ommastrephes sloani pacificus), class sigma}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

SCOP Domain Coordinates for d2gsq_1:

Click to download the PDB-style file with coordinates for d2gsq_1.
(The format of our PDB-style files is described here.)

Timeline for d2gsq_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsq_2