Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (16 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [189260] (3 PDB entries) |
Domain d3h1fa_: 3h1f A: [177147] automated match to d1e6ma_ complexed with mg, so4; mutant |
PDB Entry: 3h1f (more details), 2.2 Å
SCOPe Domain Sequences for d3h1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1fa_ c.23.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitawnmpemn gldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkeklevvl gtn
Timeline for d3h1fa_: