SCOPe 2.01: Domain d3h1fa_: 3h1f A:

Lineage for d3h1fa_ (3h1f A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (16 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [189260] (3 PDB entries)

8. Domain d3h1fa_: 3h1f A: [177147]
   automated match to d1e6ma_
   complexed with mg, so4; mutant

Details for d3h1fa_

PDB Entry: 3h1f, 2.2 Å

PDB Description: crystal structure of chey mutant d53a of helicobacter pylori

PDB Compounds: (A:) Chemotaxis protein cheY homolog

SCOPe Domain Sequences for d3h1fa_:

Sequence; same for both SEQRES and ATOM records:

>d3h1fa_ c.23.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitawnmpemn
gldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkeklevvl
gtn

Timeline for d3h1fa_:

• d3h1fa_ is new in SCOPe 2.01-stable
  
• d3h1fa_ appears in SCOPe 2.02
  
• d3h1fa_ appears in the current release, SCOPe 2.08