Lineage for d1pd221 (1pd2 2:76-199)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48306Species Rat (Rattus norvegicus), class sigma [TaxId:10116] [47630] (1 PDB entry)
  8. 48308Domain d1pd221: 1pd2 2:76-199 [17714]
    Other proteins in same PDB: d1pd212, d1pd222

Details for d1pd221

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
PDB Compounds: (2:)

SCOP Domain Sequences for d1pd221:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd221 a.45.1.1 (2:76-199) Glutathione S-transferase {Rat (Rattus norvegicus), class sigma}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

SCOP Domain Coordinates for d1pd221:

Click to download the PDB-style file with coordinates for d1pd221.
(The format of our PDB-style files is described here.)

Timeline for d1pd221:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd222