Lineage for d1pd211 (1pd2 1:76-199)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153339Species Rat (Rattus norvegicus), class sigma [TaxId:10116] [47630] (1 PDB entry)
  8. 153340Domain d1pd211: 1pd2 1:76-199 [17713]
    Other proteins in same PDB: d1pd212, d1pd222

Details for d1pd211

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd211:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd211 a.45.1.1 (1:76-199) Glutathione S-transferase {Rat (Rattus norvegicus), class sigma}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

SCOP Domain Coordinates for d1pd211:

Click to download the PDB-style file with coordinates for d1pd211.
(The format of our PDB-style files is described here.)

Timeline for d1pd211:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd212