Lineage for d3gzyb_ (3gzy B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020265Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1020312Protein automated matches [190223] (3 species)
    not a true protein
  7. 1020371Species Comamonas testosteroni [TaxId:285] [189310] (2 PDB entries)
  8. 1020372Domain d3gzyb_: 3gzy B: [177119]
    automated match to d1wqlb1
    complexed with fe2, fes, mes

Details for d3gzyb_

PDB Entry: 3gzy (more details), 1.62 Å

PDB Description: Crystal Structure of the Biphenyl Dioxygenase from Comamonas testosteroni Sp. Strain B-356
PDB Compounds: (B:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d3gzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzyb_ d.17.4.4 (B:) automated matches {Comamonas testosteroni [TaxId: 285]}
mistplskefewpakpvslelqhqveqfyyreaqlldhhafqawfallaedihywmpirt
vrtareqgleyvpaganahfddthatmygrirqktsdlnwaedppsrtrhlvsnvivrem
dtpgtlevasafllyrsrlerqvdvfagerrdvlriadnplgfqiakrtiildqstvlan
nlsvff

SCOPe Domain Coordinates for d3gzyb_:

Click to download the PDB-style file with coordinates for d3gzyb_.
(The format of our PDB-style files is described here.)

Timeline for d3gzyb_: