Lineage for d3ljra1 (3ljr A:80-244)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 214152Protein Class theta GST [81350] (1 species)
  7. 214153Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)
  8. 214158Domain d3ljra1: 3ljr A:80-244 [17711]
    Other proteins in same PDB: d3ljra2, d3ljrb2

Details for d3ljra1

PDB Entry: 3ljr (more details), 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

SCOP Domain Sequences for d3ljra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens)}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d3ljra1:

Click to download the PDB-style file with coordinates for d3ljra1.
(The format of our PDB-style files is described here.)

Timeline for d3ljra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljra2