Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class theta GST [81350] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries) |
Domain d2ljrb1: 2ljr B:80-244 [17710] Other proteins in same PDB: d2ljra2, d2ljrb2 |
PDB Entry: 2ljr (more details), 3.2 Å
SCOPe Domain Sequences for d2ljrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ljrb1 a.45.1.1 (B:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea flgaelcqeahsiilsileqaakktlptpspeayqamllriarip
Timeline for d2ljrb1: