Lineage for d2ljrb1 (2ljr B:80-244)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538815Protein Class theta GST [81350] (1 species)
  7. 538816Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)
  8. 538820Domain d2ljrb1: 2ljr B:80-244 [17710]
    Other proteins in same PDB: d2ljra2, d2ljrb2

Details for d2ljrb1

PDB Entry: 2ljr (more details), 3.2 Å

PDB Description: glutathione transferase apo-form from human

SCOP Domain Sequences for d2ljrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljrb1 a.45.1.1 (B:80-244) Class theta GST {Human (Homo sapiens)}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d2ljrb1:

Click to download the PDB-style file with coordinates for d2ljrb1.
(The format of our PDB-style files is described here.)

Timeline for d2ljrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ljrb2