Lineage for d2ljrb1 (2ljr B:80-244)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 98106Species Human (Homo sapiens), class theta [TaxId:9606] [47629] (3 PDB entries)
  8. 98110Domain d2ljrb1: 2ljr B:80-244 [17710]
    Other proteins in same PDB: d2ljra2, d2ljrb2

Details for d2ljrb1

PDB Entry: 2ljr (more details), 3.2 Å

PDB Description: glutathione transferase apo-form from human

SCOP Domain Sequences for d2ljrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljrb1 a.45.1.1 (B:80-244) Glutathione S-transferase {Human (Homo sapiens), class theta}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d2ljrb1:

Click to download the PDB-style file with coordinates for d2ljrb1.
(The format of our PDB-style files is described here.)

Timeline for d2ljrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ljrb2