SCOP 1.69: Domain d1ljrb1: 1ljr B:80-244

Lineage for d1ljrb1 (1ljr B:80-244)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class theta GST [81350] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)

8. Domain d1ljrb1: 1ljr B:80-244 [17708]
   Other proteins in same PDB: d1ljra2, d1ljrb2

Details for d1ljrb1

PDB Entry: 1ljr, 3.2 Å

PDB Description: glutathione transferase (hgst t2-2) from human

SCOP Domain Sequences for d1ljrb1:

Sequence; same for both SEQRES and ATOM records:

>d1ljrb1 a.45.1.1 (B:80-244) Class theta GST {Human (Homo sapiens)}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

Timeline for d1ljrb1:

• d1ljrb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ljrb1 appears in SCOP 1.67
  
• d1ljrb1 appears in SCOP 1.71
  
• d1ljrb1 appears in the current release, SCOPe 2.08