Lineage for d1ljrb1 (1ljr B:80-244)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3840Species Human (Homo sapiens), class theta [TaxId:9606] [47629] (3 PDB entries)
  8. 3842Domain d1ljrb1: 1ljr B:80-244 [17708]
    Other proteins in same PDB: d1ljra2, d1ljrb2

Details for d1ljrb1

PDB Entry: 1ljr (more details), 3.2 Å

PDB Description: glutathione transferase (hgst t2-2) from human

SCOP Domain Sequences for d1ljrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljrb1 a.45.1.1 (B:80-244) Glutathione S-transferase {Human (Homo sapiens), class theta}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d1ljrb1:

Click to download the PDB-style file with coordinates for d1ljrb1.
(The format of our PDB-style files is described here.)

Timeline for d1ljrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ljrb2