![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.5: G-type lysozyme [53987] (2 proteins) |
![]() | Protein automated matches [191098] (2 species) not a true protein |
![]() | Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries) |
![]() | Domain d3gxra_: 3gxr A: [177075] automated match to d153la_ |
PDB Entry: 3gxr (more details), 1.7 Å
SCOPe Domain Sequences for d3gxra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gxra_ d.2.1.5 (A:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]} ygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdpa viaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgil vnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwy kkngf
Timeline for d3gxra_: