Lineage for d3gxkd_ (3gxk D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533558Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 2533566Protein automated matches [191098] (3 species)
    not a true protein
  7. 2533567Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries)
  8. 2533575Domain d3gxkd_: 3gxk D: [177073]
    automated match to d153la_
    complexed with co

Details for d3gxkd_

PDB Entry: 3gxk (more details), 1.9 Å

PDB Description: the crystal structure of g-type lysozyme from atlantic cod (gadus morhua l.) in complex with nag oligomers sheds new light on substrate binding and the catalytic mechanism. native structure to 1.9
PDB Compounds: (D:) Goose-type lysozyme 1

SCOPe Domain Sequences for d3gxkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gxkd_ d.2.1.5 (D:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
gygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdp
aviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgi
lvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqw
ykkngf

SCOPe Domain Coordinates for d3gxkd_:

Click to download the PDB-style file with coordinates for d3gxkd_.
(The format of our PDB-style files is described here.)

Timeline for d3gxkd_: