SCOPe 2.06: Domain d3gxkc_: 3gxk C:

Lineage for d3gxkc_ (3gxk C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.5: G-type lysozyme [53987] (2 proteins)

6. Protein automated matches [191098] (3 species)
   not a true protein

7. Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries)

8. Domain d3gxkc_: 3gxk C: [177072]
   automated match to d153la_
   complexed with co

Details for d3gxkc_

PDB Entry: 3gxk, 1.9 Å

PDB Description: the crystal structure of g-type lysozyme from atlantic cod (gadus morhua l.) in complex with nag oligomers sheds new light on substrate binding and the catalytic mechanism. native structure to 1.9

PDB Compounds: (C:) Goose-type lysozyme 1

SCOPe Domain Sequences for d3gxkc_:

Sequence, based on SEQRES records:

>d3gxkc_ d.2.1.5 (C:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
wykkngf

Sequence, based on observed residues (ATOM records):

>d3gxkc_ d.2.1.5 (C:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
paviaaiisresragnyngfglmqvdkryheprgawnseehidqatgilvnfiqliqkkf
pswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykkngf

Timeline for d3gxkc_:

• d3gxkc_ first appeared in SCOPe 2.01
  
• d3gxkc_ appears in SCOPe 2.05
  
• d3gxkc_ appears in SCOPe 2.07
  
• d3gxkc_ appears in the current release, SCOPe 2.08