Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.5: G-type lysozyme [53987] (2 proteins) |
Protein automated matches [191098] (3 species) not a true protein |
Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries) |
Domain d3gxkb_: 3gxk B: [177071] automated match to d153la_ complexed with co |
PDB Entry: 3gxk (more details), 1.9 Å
SCOPe Domain Sequences for d3gxkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gxkb_ d.2.1.5 (B:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]} ditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdpavi aaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgilvn fiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykk ngf
Timeline for d3gxkb_: