Lineage for d1ljra1 (1ljr A:80-244)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153229Species Human (Homo sapiens), class theta [TaxId:9606] [47629] (3 PDB entries)
  8. 153230Domain d1ljra1: 1ljr A:80-244 [17707]
    Other proteins in same PDB: d1ljra2, d1ljrb2

Details for d1ljra1

PDB Entry: 1ljr (more details), 3.2 Å

PDB Description: glutathione transferase (hgst t2-2) from human

SCOP Domain Sequences for d1ljra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljra1 a.45.1.1 (A:80-244) Glutathione S-transferase {Human (Homo sapiens), class theta}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d1ljra1:

Click to download the PDB-style file with coordinates for d1ljra1.
(The format of our PDB-style files is described here.)

Timeline for d1ljra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ljra2