SCOP 1.55: Domain d1b48b1: 1b48 B:80-222

Lineage for d1b48b1 (1b48 B:80-222)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)

6. Protein Glutathione S-transferase [47618] (22 species)

7. Species Mouse (Mus musculus), class alpha (a1-4) [TaxId:10090] [47628] (2 PDB entries)

8. Domain d1b48b1: 1b48 B:80-222 [17704]
   Other proteins in same PDB: d1b48a2, d1b48b2

Details for d1b48b1

PDB Entry: 1b48, 2.6 Å

PDB Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4

SCOP Domain Sequences for d1b48b1:

Sequence; same for both SEQRES and ATOM records:

>d1b48b1 a.45.1.1 (B:80-222) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-4)}
nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki
lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq
pgsqrkpppdgpyvevvrivlkf

Timeline for d1b48b1:

• d1b48b1 appears in SCOP 1.57
  
• d1b48b1 appears in the current release, SCOPe 2.08