Lineage for d1f3aa1 (1f3a A:80-221)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443407Protein Class alpha GST [81349] (8 species)
  7. 443460Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [47627] (2 PDB entries)
  8. 443463Domain d1f3aa1: 1f3a A:80-221 [17701]
    Other proteins in same PDB: d1f3aa2, d1f3ab2

Details for d1f3aa1

PDB Entry: 1f3a (more details), 1.9 Å

PDB Description: crystal structure of mgsta1-1 in complex with gsh

SCOP Domain Sequences for d1f3aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3aa1 a.45.1.1 (A:80-221) Class alpha GST {Mouse (Mus musculus), (a1-1)}
lygkdmkeralidmysegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllevllyveefdaslltpfpllkafksrisslpnvkkflqp
gsqrkppmdakqiqearkafki

SCOP Domain Coordinates for d1f3aa1:

Click to download the PDB-style file with coordinates for d1f3aa1.
(The format of our PDB-style files is described here.)

Timeline for d1f3aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3aa2