Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.49: BC2162-like [142629] (2 proteins) contains extra helical regions inserted after strands 5 and 6 of the canonical fold |
Protein automated matches [191032] (1 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [188847] (1 PDB entry) |
Domain d3gu3a_: 3gu3 A: [176999] automated match to d2gh1a1 complexed with act, sah |
PDB Entry: 3gu3 (more details), 2.3 Å
SCOPe Domain Sequences for d3gu3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gu3a_ c.66.1.49 (A:) automated matches {Bacillus cereus [TaxId: 226900]} rdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgidsgetll aearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihsvkkgg kiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipiylsel gvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliargltydn alaqyeaelrffkalhlhsslvyapnmkitfgeiec
Timeline for d3gu3a_: