Lineage for d3gu3a_ (3gu3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894247Family c.66.1.49: BC2162-like [142629] (2 proteins)
    contains extra helical regions inserted after strands 5 and 6 of the canonical fold
  6. 2894252Protein automated matches [191032] (1 species)
    not a true protein
  7. 2894253Species Bacillus cereus [TaxId:226900] [188847] (1 PDB entry)
  8. 2894254Domain d3gu3a_: 3gu3 A: [176999]
    automated match to d2gh1a1
    complexed with act, sah

Details for d3gu3a_

PDB Entry: 3gu3 (more details), 2.3 Å

PDB Description: crystal structure of the methyltransferase bc_2162 in complex with s- adenosyl-l-homocysteine from bacillus cereus, northeast structural genomics consortium target bcr20
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d3gu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gu3a_ c.66.1.49 (A:) automated matches {Bacillus cereus [TaxId: 226900]}
rdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgidsgetll
aearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihsvkkgg
kiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipiylsel
gvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliargltydn
alaqyeaelrffkalhlhsslvyapnmkitfgeiec

SCOPe Domain Coordinates for d3gu3a_:

Click to download the PDB-style file with coordinates for d3gu3a_.
(The format of our PDB-style files is described here.)

Timeline for d3gu3a_: