Lineage for d1f3ba1 (1f3b A:80-222)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153257Species Mouse (Mus musculus), class alpha (a1-1) [TaxId:10090] [47627] (2 PDB entries)
  8. 153260Domain d1f3ba1: 1f3b A:80-222 [17699]
    Other proteins in same PDB: d1f3ba2, d1f3bb2

Details for d1f3ba1

PDB Entry: 1f3b (more details), 2 Å

PDB Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide

SCOP Domain Sequences for d1f3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ba1 a.45.1.1 (A:80-222) Glutathione S-transferase {Mouse (Mus musculus), class alpha (a1-1)}
lygkdmkeralidmysegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllevllyveefdaslltpfpllkafksrisslpnvkkflqp
gsqrkppmdakqiqearkafkiq

SCOP Domain Coordinates for d1f3ba1:

Click to download the PDB-style file with coordinates for d1f3ba1.
(The format of our PDB-style files is described here.)

Timeline for d1f3ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3ba2