SCOP 1.69: Domain d1ev9a1: 1ev9 A:80-220

Lineage for d1ev9a1 (1ev9 A:80-220)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries)

8. Domain d1ev9a1: 1ev9 A:80-220 [17696]
   Other proteins in same PDB: d1ev9a2, d1ev9c2, d1ev9d2

Details for d1ev9a1

PDB Entry: 1ev9, 2.2 Å

PDB Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound

SCOP Domain Sequences for d1ev9a1:

Sequence; same for both SEQRES and ATOM records:

>d1ev9a1 a.45.1.1 (A:80-220) Class alpha GST {Rat (Rattus norvegicus), (a1-1)}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkif

Timeline for d1ev9a1:

• d1ev9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ev9a1 appears in SCOP 1.67
  
• d1ev9a1 appears in SCOP 1.71
  
• d1ev9a1 appears in the current release, SCOPe 2.08