Lineage for d1ev9a1 (1ev9 A:80-220)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3896Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [47626] (2 PDB entries)
  8. 3900Domain d1ev9a1: 1ev9 A:80-220 [17696]
    Other proteins in same PDB: d1ev9a2, d1ev9c2, d1ev9d2

Details for d1ev9a1

PDB Entry: 1ev9 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound

SCOP Domain Sequences for d1ev9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev9a1 a.45.1.1 (A:80-220) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkif

SCOP Domain Coordinates for d1ev9a1:

Click to download the PDB-style file with coordinates for d1ev9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ev9a1: