SCOPe 2.03: Domain d1ev4d1: 1ev4 D:80-222

Lineage for d1ev4d1 (1ev4 D:80-222)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries)

8. Domain d1ev4d1: 1ev4 D:80-222 [17695]
   Other proteins in same PDB: d1ev4a2, d1ev4c2, d1ev4d2
   complexed with gts, so4; mutant

Details for d1ev4d1

PDB Entry: 1ev4, 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound

PDB Compounds: (D:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1ev4d1:

Sequence; same for both SEQRES and ATOM records:

>d1ev4d1 a.45.1.1 (D:80-222) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkiykf

Timeline for d1ev4d1:

• d1ev4d1 first appeared (with stable ids) in SCOP 1.55
  
• d1ev4d1 appears in SCOPe 2.02
  
• d1ev4d1 appears in SCOPe 2.04
  
• d1ev4d1 appears in the current release, SCOPe 2.08