Lineage for d1ev4a1 (1ev4 A:80-222)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48266Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [47626] (2 PDB entries)
  8. 48267Domain d1ev4a1: 1ev4 A:80-222 [17693]
    Other proteins in same PDB: d1ev4a2, d1ev4c2, d1ev4d2

Details for d1ev4a1

PDB Entry: 1ev4 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound

SCOP Domain Sequences for d1ev4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev4a1 a.45.1.1 (A:80-222) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkiykf

SCOP Domain Coordinates for d1ev4a1:

Click to download the PDB-style file with coordinates for d1ev4a1.
(The format of our PDB-style files is described here.)

Timeline for d1ev4a1: