Lineage for d1agsb1 (1ags B:80-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712858Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2712967Domain d1agsb1: 1ags B:80-221 [17692]
    Other proteins in same PDB: d1agsa2, d1agsb2
    complexed with gtx; mutant

Details for d1agsb1

PDB Entry: 1ags (more details), 2.5 Å

PDB Description: a surface mutant (g82r) of a human alpha-glutathione s-transferase shows decreased thermal stability and a new mode of molecular association in the crystal
PDB Compounds: (B:) glutathione s-transferase alpha

SCOPe Domain Sequences for d1agsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agsb1 a.45.1.1 (B:80-221) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lyrkdikekalidmyiegiadlgemilllpftqpeeqdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d1agsb1:

Click to download the PDB-style file with coordinates for d1agsb1.
(The format of our PDB-style files is described here.)

Timeline for d1agsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agsb2