SCOPe 2.06: Domain d3gqgb_: 3gqg B:

Lineage for d3gqgb_ (3gqg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)

8. Domain d3gqgb_: 3gqg B: [176910]
   Other proteins in same PDB: d3gqga_, d3gqgc_
   automated match to d1hbhb_
   complexed with hem

Details for d3gqgb_

PDB Entry: 3gqg, 1.73 Å

PDB Description: Crystal structure at acidic pH of the ferric form of the Root effect hemoglobin from Trematomus bernacchii.

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3gqgb_:

Sequence; same for both SEQRES and ATOM records:

>d3gqgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d3gqgb_:

• d3gqgb_ first appeared in SCOPe 2.01
  
• d3gqgb_ appears in SCOPe 2.05
  
• d3gqgb_ appears in SCOPe 2.07
  
• d3gqgb_ appears in the current release, SCOPe 2.08