Lineage for d3gqgb_ (3gqg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687079Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)
  8. 2687083Domain d3gqgb_: 3gqg B: [176910]
    Other proteins in same PDB: d3gqga_, d3gqgc_
    automated match to d1hbhb_
    complexed with hem

Details for d3gqgb_

PDB Entry: 3gqg (more details), 1.73 Å

PDB Description: Crystal structure at acidic pH of the ferric form of the Root effect hemoglobin from Trematomus bernacchii.
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3gqgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d3gqgb_:

Click to download the PDB-style file with coordinates for d3gqgb_.
(The format of our PDB-style files is described here.)

Timeline for d3gqgb_: