SCOPe 2.01: Domain d3gqfa_: 3gqf A:

Lineage for d3gqfa_ (3gqf A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (55 PDB entries)

8. Domain d3gqfa_: 3gqf A: [176903]
   automated match to d1oezw_
   complexed with ca, zn

Details for d3gqfa_

PDB Entry: 3gqf, 2.2 Å

PDB Description: structural and biophysical properties of the pathogenic sod1 variant h46r/h48q

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3gqfa_:

Sequence; same for both SEQRES and ATOM records:

>d3gqfa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d3gqfa_:

• d3gqfa_ is new in SCOPe 2.01-stable
  
• d3gqfa_ appears in SCOPe 2.02
  
• d3gqfa_ appears in the current release, SCOPe 2.08