SCOPe 2.03: Domain d3gpwh_: 3gpw H:

Lineage for d3gpwh_ (3gpw H:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3gpwh_: 3gpw H: [176881]
   Other proteins in same PDB: d3gpwa_, d3gpwb_, d3gpwc_, d3gpwe_, d3gpwf_, d3gpwg_, d3gpwo_, d3gpwp_, d3gpwq_, d3gpws_, d3gpwt_, d3gpwu_
   automated match to d1g0uh_
   complexed with sa1

Details for d3gpwh_

PDB Entry: 3gpw, 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with Salinosporamide derivatives: irreversible inhibitor ligand

PDB Compounds: (H:) Proteasome component PUP1

SCOPe Domain Sequences for d3gpwh_:

Sequence; same for both SEQRES and ATOM records:

>d3gpwh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

Timeline for d3gpwh_:

• d3gpwh_ first appeared in SCOPe 2.01
  
• d3gpwh_ appears in SCOPe 2.02
  
• d3gpwh_ appears in SCOPe 2.04
  
• d3gpwh_ appears in the current release, SCOPe 2.08