Lineage for d1gume1 (1gum E:81-220)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281538Protein Class alpha GST [81349] (8 species)
  7. 281548Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (10 PDB entries)
  8. 281575Domain d1gume1: 1gum E:81-220 [17687]
    Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2

Details for d1gume1

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

SCOP Domain Sequences for d1gume1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gume1 a.45.1.1 (E:81-220) Class alpha GST {Human (Homo sapiens), (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOP Domain Coordinates for d1gume1:

Click to download the PDB-style file with coordinates for d1gume1.
(The format of our PDB-style files is described here.)

Timeline for d1gume1: