Lineage for d1gume1 (1gum E:81-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712858Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2712962Domain d1gume1: 1gum E:81-220 [17687]
    Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2

Details for d1gume1

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands
PDB Compounds: (E:) protein (glutathione transferase a4-4)

SCOPe Domain Sequences for d1gume1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gume1 a.45.1.1 (E:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOPe Domain Coordinates for d1gume1:

Click to download the PDB-style file with coordinates for d1gume1.
(The format of our PDB-style files is described here.)

Timeline for d1gume1: