SCOPe 2.04: Domain d3gptv_: 3gpt V:

Lineage for d3gptv_ (3gpt V:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3gptv_: 3gpt V: [176868]
   Other proteins in same PDB: d3gpta_, d3gptb_, d3gptc_, d3gpte_, d3gptf_, d3gptg_, d3gpto_, d3gptp_, d3gptq_, d3gpts_, d3gptt_, d3gptu_
   automated match to d1g0uh_
   complexed with gpt

Details for d3gptv_

PDB Entry: 3gpt, 2.41 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with Salinosporamide derivatives: slow substrate ligand

PDB Compounds: (V:) Proteasome component PUP1

SCOPe Domain Sequences for d3gptv_:

Sequence; same for both SEQRES and ATOM records:

>d3gptv_ d.153.1.4 (V:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

Timeline for d3gptv_:

• d3gptv_ first appeared in SCOPe 2.01
  
• d3gptv_ appears in SCOPe 2.03
  
• d3gptv_ appears in SCOPe 2.05
  
• d3gptv_ appears in the current release, SCOPe 2.08