SCOPe 2.02: Domain d3gptu_: 3gpt U:

Lineage for d3gptu_ (3gpt U:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries)

8. Domain d3gptu_: 3gpt U: [176867]
   Other proteins in same PDB: d3gpt1_, d3gpt2_, d3gpta_, d3gptb_, d3gptc_, d3gptd_, d3gpte_, d3gptf_, d3gpth_, d3gpti_, d3gptj_, d3gptk_, d3gptl_, d3gptm_, d3gptn_, d3gpto_, d3gptp_, d3gptq_, d3gptr_, d3gpts_, d3gptt_, d3gptv_, d3gptw_, d3gptx_, d3gpty_, d3gptz_
   automated match to d1g65g_
   complexed with gpt

Details for d3gptu_

PDB Entry: 3gpt, 2.41 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with Salinosporamide derivatives: slow substrate ligand

PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3gptu_:

Sequence; same for both SEQRES and ATOM records:

>d3gptu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

Timeline for d3gptu_:

• d3gptu_ first appeared in SCOPe 2.01
  
• d3gptu_ appears in SCOPe 2.03
  
• d3gptu_ appears in the current release, SCOPe 2.08