Lineage for d1gumd1 (1gum D:81-220)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48079Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 48099Domain d1gumd1: 1gum D:81-220 [17686]
    Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2

Details for d1gumd1

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

SCOP Domain Sequences for d1gumd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gumd1 a.45.1.1 (D:81-220) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOP Domain Coordinates for d1gumd1:

Click to download the PDB-style file with coordinates for d1gumd1.
(The format of our PDB-style files is described here.)

Timeline for d1gumd1: