Lineage for d1gumb1 (1gum B:81-220)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97963Protein Glutathione S-transferase [47618] (24 species)
  7. 97979Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 97997Domain d1gumb1: 1gum B:81-220 [17684]
    Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2

Details for d1gumb1

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

SCOP Domain Sequences for d1gumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gumb1 a.45.1.1 (B:81-220) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOP Domain Coordinates for d1gumb1:

Click to download the PDB-style file with coordinates for d1gumb1.
(The format of our PDB-style files is described here.)

Timeline for d1gumb1: