Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
Domain d3gpju_: 3gpj U: [176837] Other proteins in same PDB: d3gpj1_, d3gpj2_, d3gpja_, d3gpjb_, d3gpjc_, d3gpje_, d3gpjf_, d3gpjh_, d3gpji_, d3gpjj_, d3gpjk_, d3gpjl_, d3gpjm_, d3gpjn_, d3gpjo_, d3gpjp_, d3gpjq_, d3gpjs_, d3gpjt_, d3gpjv_, d3gpjw_, d3gpjx_, d3gpjy_, d3gpjz_ automated match to d1g65g_ complexed with sy2 |
PDB Entry: 3gpj (more details), 2.7 Å
SCOPe Domain Sequences for d3gpju_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gpju_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3gpju_: